PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_06291A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 357aa    MW: 38337.5 Da    PI: 7.0729
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_06291AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.22.8e-161462148
                               TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                               +g+W++eEd +l+d++++ G+g +W + +++ g++R++k+c++rw++yl
  Oropetium_20150105_06291A 14 KGPWSPEEDRKLKDYIHKNGTGgNWIALPHKAGLKRCGKSCRLRWLNYL 62
                               79*********************************************97 PP

2Myb_DNA-binding38.52.7e-1269111246
                                SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                g ++++Ed ++  +++  G++ W+ Ia+ ++ gRt++++k++w++
  Oropetium_20150105_06291A  69 GDFSEDEDRIICSLFATIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                                689******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.096962IPR017930Myb domain
SuperFamilySSF466891.95E-2611109IPR009057Homeodomain-like
SMARTSM007173.3E-121364IPR001005SANT/Myb domain
PfamPF002492.7E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-231569IPR009057Homeodomain-like
CDDcd001672.14E-91662No hitNo description
PROSITE profilePS5129422.08363117IPR017930Myb domain
SMARTSM007176.9E-1267115IPR001005SANT/Myb domain
PfamPF002492.4E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-2370118IPR009057Homeodomain-like
CDDcd001671.44E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MGRAPCCDKA SVKKGPWSPE EDRKLKDYIH KNGTGGNWIA LPHKAGLKRC GKSCRLRWLN  60
YLRPNIKHGD FSEDEDRIIC SLFATIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLMQA  120
HGLHPTTHRH RRSKKQQQQS LFFSTEEEAP SPAPLALTLA DPCLSLQYLS TSAHNFTHQY  180
GGHDDSTSTT SSLLCAGGGL MFGGINNGDG EQHVMSSSAG SDSVAGGLGL YFEFCNNGGG  240
SGSHGHDDDD HSAAAVAVAA GLAVESFVLR DDDHHNNKAP LLLAAGPETS LDYYQYGADT  300
SYGYDEEAAA AKPFAPAGGG GGSSSAFFEF YGYSQEKSGS SCPAVAGVCQ QRRFMY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004956269.14e-96PREDICTED: myb-related protein Hv1-like
TrEMBLK3ZVB34e-96K3ZVB3_SETIT; Uncharacterized protein
STRINGSi030544m1e-95(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.12e-74myb domain protein 36